SCOPe 2.05: Domain d2grla2: 2grl A:67-287

Lineage for d2grla2 (2grl A:67-287)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)

6. Protein automated matches [254479] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)

8. Domain d2grla2: 2grl A:67-287 [135561]
   Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1
   automated match to d2awia2

Details for d2grla2

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2grla2:

Sequence; same for both SEQRES and ATOM records:

>d2grla2 a.118.8.4 (A:67-287) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisake

Timeline for d2grla2:

• d2grla2 first appeared in SCOP 1.73
  
• d2grla2 appears in SCOPe 2.04
  
• d2grla2 appears in SCOPe 2.06
  
• d2grla2 appears in the current release, SCOPe 2.08