Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) |
Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
Protein Deblocking aminopeptidase YhfE [141387] (1 species) |
Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry) Uniprot Q81HB5 74-186 BC0901 |
Domain d2greb1: 2gre B:74-186 [135530] Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2 automated match to d2grea1 complexed with so4 |
PDB Entry: 2gre (more details), 2.65 Å
SCOPe Domain Sequences for d2greb1:
Sequence, based on SEQRES records: (download)
>d2greb1 b.49.3.1 (B:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld
>d2greb1 b.49.3.1 (B:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmievridervfsad evrelgievgdfvsfdprvqitesgyiksrhld
Timeline for d2greb1:
View in 3D Domains from other chains: (mouse over for more information) d2grea1, d2grea2, d2grec1, d2grec2, d2gred1, d2gred2, d2gree1, d2gree2, d2gref1, d2gref2, d2greg1, d2greg2, d2greh1, d2greh2, d2grei1, d2grei2, d2grej1, d2grej2, d2grek1, d2grek2, d2grel1, d2grel2, d2grem1, d2grem2, d2gren1, d2gren2, d2greo1, d2greo2, d2grep1, d2grep2 |