SCOP 1.73: Domain d2grea1: 2gre A:74-186

Lineage for d2grea1 (2gre A:74-186)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)

6. Protein Deblocking aminopeptidase YhfE [141387] (1 species)

7. Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry)
   BC0901

8. Domain d2grea1: 2gre A:74-186 [135528]
   Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2
   complexed with so4

Details for d2grea1

PDB Entry: 2gre, 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus

PDB Compounds: (A:) Deblocking aminopeptidase

SCOP Domain Sequences for d2grea1:

Sequence, based on SEQRES records:

>d2grea1 b.49.3.1 (A:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage
akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld

Sequence, based on observed residues (ATOM records):

>d2grea1 b.49.3.1 (A:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhievridervfsa
devrelgievgdfvsfdprvqitesgyiksrhld

Timeline for d2grea1:

• d2grea1 is new in SCOP 1.73
  
• d2grea1 appears in SCOP 1.75
  
• d2grea1 appears in the current release, SCOPe 2.08