![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
![]() | Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) ![]() |
![]() | Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
![]() | Protein Deblocking aminopeptidase YhfE [141387] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry) BC0901 |
![]() | Domain d2grep1: 2gre P:74-186 [135558] Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2 automatically matched to 2GRE A:74-186 complexed with so4 |
PDB Entry: 2gre (more details), 2.65 Å
SCOP Domain Sequences for d2grep1:
Sequence, based on SEQRES records: (download)
>d2grep1 b.49.3.1 (P:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld
>d2grep1 b.49.3.1 (P:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmievridervfsad evrelgievgdfvsfdprvqitesgyiksrhld
Timeline for d2grep1:
![]() Domains from other chains: (mouse over for more information) d2grea1, d2grea2, d2greb1, d2greb2, d2grec1, d2grec2, d2gred1, d2gred2, d2gree1, d2gree2, d2gref1, d2gref2, d2greg1, d2greg2, d2greh1, d2greh2, d2grei1, d2grei2, d2grej1, d2grej2, d2grek1, d2grek2, d2grel1, d2grel2, d2grem1, d2grem2, d2gren1, d2gren2, d2greo1, d2greo2 |