SCOP 1.73: Domain d2gr7e1: 2gr7 E:998-1098

Lineage for d2gr7e1 (2gr7 E:998-1098)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (4 families)
   bacterial filament proteins

5. Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein)
   Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil

6. Protein Adhesin Hia [143108] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries)

8. Domain d2gr7e1: 2gr7 E:998-1098 [135520]
   automatically matched to 2GR7 A:998-1098
   complexed with c8e

Details for d2gr7e1

PDB Entry: 2gr7, 2.3 Å

PDB Description: Hia 992-1098

PDB Compounds: (E:) adhesin

SCOP Domain Sequences for d2gr7e1:

Sequence; same for both SEQRES and ATOM records:

>d2gr7e1 d.24.1.4 (E:998-1098) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw

Timeline for d2gr7e1:

• d2gr7e1 is new in SCOP 1.73
  
• d2gr7e1 appears in SCOP 1.75
  
• d2gr7e1 appears in the current release, SCOPe 2.08, called d2gr7e_