Lineage for d2gr7a1 (2gr7 A:998-1098)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720355Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 720356Superfamily d.24.1: Pili subunits [54523] (4 families) (S)
    bacterial filament proteins
  5. 720394Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein)
    Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil
  6. 720395Protein Adhesin Hia [143108] (1 species)
  7. 720396Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries)
  8. 720403Domain d2gr7a1: 2gr7 A:998-1098 [135516]
    complexed with c8e

Details for d2gr7a1

PDB Entry: 2gr7 (more details), 2.3 Å

PDB Description: Hia 992-1098
PDB Compounds: (A:) adhesin

SCOP Domain Sequences for d2gr7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gr7a1 d.24.1.4 (A:998-1098) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw

SCOP Domain Coordinates for d2gr7a1:

Click to download the PDB-style file with coordinates for d2gr7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gr7a1: