SCOP 1.73: Domain d2gmhb2: 2gmh B:237-335

Lineage for d2gmhb2 (2gmh B:237-335)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.8: Electron transfer flavoprotein-ubiquinone oxidoreductase-like [142988] (1 protein)

6. Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [142989] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [142990] (2 PDB entries)

8. Domain d2gmhb2: 2gmh B:237-335 [135379]
   Other proteins in same PDB: d2gmha1, d2gmha3, d2gmhb1, d2gmhb3
   automatically matched to 2GMH A:237-335
   complexed with bhg, edo, fad, na, sf4, uq5

Details for d2gmhb2

PDB Entry: 2gmh, 2.5 Å

PDB Description: structure of porcine electron transfer flavoprotein-ubiquinone oxidoreductase in complexed with ubiquinone

PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOP Domain Sequences for d2gmhb2:

Sequence; same for both SEQRES and ATOM records:

>d2gmhb2 d.16.1.8 (B:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
tygiglkelwvidekkwkpgrvdhtvgwpldrhtyggsflyhlnegepllalgfvvgldy
qnpylspfrefqrwkhhpsikptleggkriaygaralne

Timeline for d2gmhb2:

• d2gmhb2 is new in SCOP 1.73
  
• d2gmhb2 appears in SCOP 1.75
  
• d2gmhb2 appears in the current release, SCOPe 2.08