SCOP 1.73: Domain d2gmhb3: 2gmh B:483-584

Lineage for d2gmhb3 (2gmh B:483-584)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.6: ETF-QO domain-like [143256] (1 protein)
   Pfam PF05187; Electron transfer flavoprotein-ubiquinone oxidoreductase; contains single Fe4-S4 cluster

6. Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [143257] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [143258] (2 PDB entries)

8. Domain d2gmhb3: 2gmh B:483-584 [135380]
   Other proteins in same PDB: d2gmha1, d2gmha2, d2gmhb1, d2gmhb2
   automatically matched to 2GMH A:483-584
   complexed with bhg, edo, fad, na, sf4, uq5

Details for d2gmhb3

PDB Entry: 2gmh, 2.5 Å

PDB Description: structure of porcine electron transfer flavoprotein-ubiquinone oxidoreductase in complexed with ubiquinone

PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOP Domain Sequences for d2gmhb3:

Sequence; same for both SEQRES and ATOM records:

>d2gmhb3 d.58.1.6 (B:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
fdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleqgd
gfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm

Timeline for d2gmhb3:

• d2gmhb3 is new in SCOP 1.73
  
• d2gmhb3 appears in SCOP 1.75
  
• d2gmhb3 appears in the current release, SCOPe 2.08