Lineage for d2gmhb3 (2gmh B:483-584)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723608Family d.58.1.6: ETF-QO domain-like [143256] (1 protein)
    Pfam PF05187; Electron transfer flavoprotein-ubiquinone oxidoreductase; contains single Fe4-S4 cluster
  6. 723609Protein Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO [143257] (1 species)
  7. 723610Species Pig (Sus scrofa) [TaxId:9823] [143258] (2 PDB entries)
  8. 723612Domain d2gmhb3: 2gmh B:483-584 [135380]
    Other proteins in same PDB: d2gmha1, d2gmha2, d2gmhb1, d2gmhb2
    automatically matched to 2GMH A:483-584
    complexed with bhg, edo, fad, na, sf4, uq5

Details for d2gmhb3

PDB Entry: 2gmh (more details), 2.5 Å

PDB Description: structure of porcine electron transfer flavoprotein-ubiquinone oxidoreductase in complexed with ubiquinone
PDB Compounds: (B:) Electron transfer flavoprotein-ubiquinone oxidoreductase

SCOP Domain Sequences for d2gmhb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmhb3 d.58.1.6 (B:483-584) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}
fdllssvalsgtnhehdqpahltlkddsvpvnrnlsiydgpeqrfcpagvyefvpleqgd
gfrlqinaqncvhcktcdikdpsqninwvvpeggggpayngm

SCOP Domain Coordinates for d2gmhb3:

Click to download the PDB-style file with coordinates for d2gmhb3.
(The format of our PDB-style files is described here.)

Timeline for d2gmhb3: