Class a: All alpha proteins [46456] (284 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
Protein automated matches [190172] (8 species) not a true protein |
Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries) |
Domain d2gm7d_: 2gm7 D: [135367] Other proteins in same PDB: d2gm7a1 automated match to d1udda_ complexed with gol, pe4, po4 |
PDB Entry: 2gm7 (more details), 2.8 Å
SCOPe Domain Sequences for d2gm7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gm7d_ a.132.1.0 (D:) automated matches {Pyrobaculum aerophilum [TaxId: 178306]} hhhhgvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalsl aasrapsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylk stcalegfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverl ravldssglsaeelwpyfkeaslyelefwqaayegh
Timeline for d2gm7d_: