Lineage for d2glga1 (2glg A:1-32)

  1. Root: SCOP 1.73
  2. 756025Class j: Peptides [58231] (120 folds)
  3. 756238Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 756239Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 756240Family j.6.1.1: Peptide hormones [58285] (18 proteins)
  6. 756241Protein Calcitonin [58301] (3 species)
  7. 756242Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [144318] (2 PDB entries)
  8. 756243Domain d2glga1: 2glg A:1-32 [135342]

Details for d2glga1

PDB Entry: 2glg (more details)

PDB Description: nmr structure of the [l23,a24]-sct mutant
PDB Compounds: (A:) Calcitonin-1

SCOP Domain Sequences for d2glga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glga1 j.6.1.1 (A:1-32) Calcitonin {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
csnlstcvlgklsqelhklqtylatntgsgtp

SCOP Domain Coordinates for d2glga1:

Click to download the PDB-style file with coordinates for d2glga1.
(The format of our PDB-style files is described here.)

Timeline for d2glga1: