PDB entry 2glg

View 2glg on RCSB PDB site
Description: NMR structure of the [L23,A24]-sCT mutant
Class: hormone/growth factor
Keywords: a-helix
Deposited on 2006-04-04, released 2006-06-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-05, with a file datestamp of 2007-07-20.
Experiment type: NMR100
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Calcitonin-1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01263 (0-31)
    • engineered (22-23)
  Domains in SCOP 1.73: d2glga1
• Heterogens: NH2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2glgA (A:)
  csnlstcvlgklsqelhklqtylatntgsgtp