Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries) |
Domain d2gk1f2: 2gk1 F:54-199 [135324] Other proteins in same PDB: d2gk1a1, d2gk1a2, d2gk1b1, d2gk1c1, d2gk1c2, d2gk1d1, d2gk1e1, d2gk1e2, d2gk1f1, d2gk1g1, d2gk1g2, d2gk1h1 automatically matched to d1o7aa2 complexed with ngt |
PDB Entry: 2gk1 (more details), 3.25 Å
SCOPe Domain Sequences for d2gk1f2:
Sequence, based on SEQRES records: (download)
>d2gk1f2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle tfsqlvyqdsygtftinestiidspr
>d2gk1f2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf tinestiidspr
Timeline for d2gk1f2: