Lineage for d2gjed1 (2gje D:28-173)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937473Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
    helix-swapped dimer of beta(4)-alpha motifs
  4. 2937474Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families) (S)
  5. 2937514Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 proteins)
    includes PfamB PB080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
    automatically mapped to Pfam PF09387
  6. 2937515Protein GBP21 [143044] (1 species)
    Mitochondrial RNA binding protein 1, MRP1
  7. 2937516Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143045] (3 PDB entries)
    Uniprot P90629 28-173
  8. 2937523Domain d2gjed1: 2gje D:28-173 [135282]
    automatically matched to 2GIA B:28-173
    protein/RNA complex

Details for d2gjed1

PDB Entry: 2gje (more details), 3.37 Å

PDB Description: Structure of a guideRNA-binding protein complex bound to a gRNA
PDB Compounds: (D:) mitochondrial RNA-binding protein 1

SCOPe Domain Sequences for d2gjed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjed1 d.18.1.4 (D:28-173) GBP21 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
nhfavtlehflesaldesfgfrqhya

SCOPe Domain Coordinates for d2gjed1:

Click to download the PDB-style file with coordinates for d2gjed1.
(The format of our PDB-style files is described here.)

Timeline for d2gjed1: