PDB entry 2gje

View 2gje on RCSB PDB site
Description: Structure of a guideRNA-binding protein complex bound to a gRNA
Class: translation/RNA
Keywords: guide RNA; kRNA editing; RNA binding protein, TRANSLATION-RNA COMPLEX
Deposited on 2006-03-30, released 2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.37 Å
R-factor: 0.282
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial RNA-binding protein 2
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q952G2
      • modified residue (80)
      • modified residue (95)
      • modified residue (174)
  • Chain 'D':
    Compound: mitochondrial RNA-binding protein 1
    Species: TRYPANOSOMA BRUCEI [TaxId:185431]
    Gene: mrp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90629
      • conflict (23)
      • modified residue (26)
      • modified residue (89)
      • modified residue (119)
    Domains in SCOPe 2.08: d2gjed1
  • Chain 'R':
    Compound: guide RNA 40-mer
  • Chain 'S':
    Compound: RNA tetramer
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gjeD (D:)
    astfsgvqslpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfd
    adrrisvrlrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrm
    edwsvkfdnhfavtlehflesaldesfgfrqhyatraaeggekiaatssaeggarrkrsv
    sdtsryh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gjeD (D:)
    qslpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisv
    rlrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkf
    dnhfavtlehflesaldesfgfrqhya
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.