SCOPe 2.06: Domain d2giab1: 2gia B:28-173

Lineage for d2giab1 (2gia B:28-173)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.18: ssDNA-binding transcriptional regulator domain [54446] (1 superfamily)
   helix-swapped dimer of beta(4)-alpha motifs

4. Superfamily d.18.1: ssDNA-binding transcriptional regulator domain [54447] (5 families)

5. Family d.18.1.4: Guide RNA binding protein gBP [143043] (2 proteins)
   includes PfamB PB080318 and PB073991; forms heterooligomers; similar subunit and oligomeric structures to the Plant transcriptional regulator family
   automatically mapped to Pfam PF09387

6. Protein GBP21 [143044] (1 species)
   Mitochondrial RNA binding protein 1, MRP1

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [143045] (3 PDB entries)
   Uniprot P90629 28-173

8. Domain d2giab1: 2gia B:28-173 [135222]
   Other proteins in same PDB: d2giaa1, d2giag_
   complexed with acy

Details for d2giab1

PDB Entry: 2gia, 1.89 Å

PDB Description: Crystal structures of trypanosoma bruciei MRP1/MRP2

PDB Compounds: (B:) mitochondrial RNA-binding protein 1

SCOPe Domain Sequences for d2giab1:

Sequence; same for both SEQRES and ATOM records:

>d2giab1 d.18.1.4 (B:28-173) GBP21 {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
slpkfeihdvrddpaegtmtrvavdgklllisqypqlgprkvdpndlspqfdadrrisvr
lrhvdlaylvgvckervprhrmetkaytldfeksaqgyhlhgkvhrvasqrmedwsvkfd
nhfavtlehflesaldesfgfrqhya

Timeline for d2giab1:

• d2giab1 first appeared in SCOP 1.73
  
• d2giab1 appears in SCOPe 2.05
  
• d2giab1 appears in SCOPe 2.07
  
• d2giab1 appears in the current release, SCOPe 2.08