Lineage for d2ghua1 (2ghu A:1-241)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1398966Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1399202Protein Falcipain 2 [142846] (1 species)
  7. 1399203Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (5 PDB entries)
    Uniprot Q9N6S8 244-484
  8. 1399207Domain d2ghua1: 2ghu A:1-241 [135210]
    automatically matched to 1YVB A:0-212

Details for d2ghua1

PDB Entry: 2ghu (more details), 3.1 Å

PDB Description: Crystal structure of falcipain-2 from Plasmodium falciparum
PDB Compounds: (A:) falcipain 2

SCOPe Domain Sequences for d2ghua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghua1 d.3.1.1 (A:1-241) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

SCOPe Domain Coordinates for d2ghua1:

Click to download the PDB-style file with coordinates for d2ghua1.
(The format of our PDB-style files is described here.)

Timeline for d2ghua1: