SCOP 1.73: Domain d2ghua1: 2ghu A:1-241

Lineage for d2ghua1 (2ghu A:1-241)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein Falcipain 2 [142846] (1 species)

7. Species Plasmodium falciparum [TaxId:5833] [142847] (2 PDB entries)

8. Domain d2ghua1: 2ghu A:1-241 [135210]
   automatically matched to 1YVB A:0-212

Details for d2ghua1

PDB Entry: 2ghu, 3.1 Å

PDB Description: Crystal structure of falcipain-2 from Plasmodium falciparum

PDB Compounds: (A:) falcipain 2

SCOP Domain Sequences for d2ghua1:

Sequence; same for both SEQRES and ATOM records:

>d2ghua1 d.3.1.1 (A:1-241) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

Timeline for d2ghua1:

• d2ghua1 is new in SCOP 1.73
  
• d2ghua1 appears in SCOP 1.75
  
• d2ghua1 appears in the current release, SCOPe 2.08, called d2ghua_