Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (1 PDB entry) |
Domain d2ghpa3: 2ghp A:206-291 [135186] |
PDB Entry: 2ghp (more details), 2.7 Å
SCOP Domain Sequences for d2ghpa3:
Sequence, based on SEQRES records: (download)
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tlegreimirnlstelldenllresfegfgsiekinipagqkehsfnnccafmvfenkds aeralqmnrsllgnreisvsladkkp
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tlegreimirnlstelldenllresfegfgsiekinipagqkfnnccafmvfenkdsaer alqmnrsllgnreisvsladkkp
Timeline for d2ghpa3: