Lineage for d2ghpa3 (2ghp A:206-291)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724656Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species)
    contains three RBDs
  7. 724657Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (1 PDB entry)
  8. 724660Domain d2ghpa3: 2ghp A:206-291 [135186]

Details for d2ghpa3

PDB Entry: 2ghp (more details), 2.7 Å

PDB Description: crystal structure of the n-terminal 3 rna binding domains of the yeast splicing factor prp24
PDB Compounds: (A:) U4/U6 snRNA-associated splicing factor PRP24

SCOP Domain Sequences for d2ghpa3:

Sequence, based on SEQRES records: (download)

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlegreimirnlstelldenllresfegfgsiekinipagqkehsfnnccafmvfenkds
aeralqmnrsllgnreisvsladkkp

Sequence, based on observed residues (ATOM records): (download)

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlegreimirnlstelldenllresfegfgsiekinipagqkfnnccafmvfenkdsaer
alqmnrsllgnreisvsladkkp

SCOP Domain Coordinates for d2ghpa3:

Click to download the PDB-style file with coordinates for d2ghpa3.
(The format of our PDB-style files is described here.)

Timeline for d2ghpa3: