| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
| Domain d2ggxb2: 2ggx B:205-234 [135167] Other proteins in same PDB: d2ggxa1, d2ggxb1, d2ggxc1 complexed with ca, npj |
PDB Entry: 2ggx (more details), 1.9 Å
SCOPe Domain Sequences for d2ggxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggxb2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d2ggxb2:
View in 3DDomains from other chains: (mouse over for more information) d2ggxa1, d2ggxa2, d2ggxc1, d2ggxc2 |