Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) |
Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
Protein Surfactant protein [57949] (2 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
Domain d2ggxc2: 2ggx C:205-234 [135169] Other proteins in same PDB: d2ggxa1, d2ggxb1, d2ggxc1 complexed with ca, npj |
PDB Entry: 2ggx (more details), 1.9 Å
SCOPe Domain Sequences for d2ggxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggxc2 h.1.1.1 (C:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d2ggxc2:
View in 3D Domains from other chains: (mouse over for more information) d2ggxa1, d2ggxa2, d2ggxb1, d2ggxb2 |