Lineage for d2gguc1 (2ggu C:235-355)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235028Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 2235029Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)
  8. 2235047Domain d2gguc1: 2ggu C:235-355 [135162]
    Other proteins in same PDB: d2ggua2, d2ggub2, d2gguc2
    automated match to d1pwba1
    complexed with ca, mlr

Details for d2gguc1

PDB Entry: 2ggu (more details), 1.9 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with maltotriose
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2gguc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gguc1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2gguc1:

Click to download the PDB-style file with coordinates for d2gguc1.
(The format of our PDB-style files is described here.)

Timeline for d2gguc1: