SCOPe 2.01: Domain d2ggeh2: 2gge H:4-118

Lineage for d2ggeh2 (2gge H:4-118)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Hypothetical protein YitF [143248] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [143249] (2 PDB entries)
   Uniprot O06741 1-114

8. Domain d2ggeh2: 2gge H:4-118 [135143]
   Other proteins in same PDB: d2ggea1, d2ggeb1, d2ggec1, d2gged1, d2ggee1, d2ggef1, d2ggeg1, d2ggeh1
   automatically matched to 2GDQ A:4-118
   complexed with cl, mg

Details for d2ggeh2

PDB Entry: 2gge, 1.89 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a

PDB Compounds: (H:) yitF

SCOPe Domain Sequences for d2ggeh2:

Sequence; same for both SEQRES and ATOM records:

>d2ggeh2 d.54.1.1 (H:4-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
vkivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgft
kriipfllgkqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwgg

Timeline for d2ggeh2:

• d2ggeh2 first appeared in SCOP 1.73
  
• d2ggeh2 appears in SCOP 1.75
  
• d2ggeh2 appears in SCOPe 2.02
  
• d2ggeh2 appears in the current release, SCOPe 2.08