Lineage for d2gcja1 (2gcj A:238-474)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803661Family b.55.1.10: SSRP1-like [141436] (2 proteins)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 2803662Protein FACT complex subunit POB3, middle domain [141437] (1 species)
  7. 2803663Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries)
    Uniprot Q04636 237-474! Uniprot Q04636 238-474
  8. 2803665Domain d2gcja1: 2gcj A:238-474 [134987]

Details for d2gcja1

PDB Entry: 2gcj (more details), 2.55 Å

PDB Description: crystal structure of the pob3 middle domain
PDB Compounds: (A:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOPe Domain Sequences for d2gcja1:

Sequence, based on SEQRES records: (download)

>d2gcja1 b.55.1.10 (A:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Sequence, based on observed residues (ATOM records): (download)

>d2gcja1 b.55.1.10 (A:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

SCOPe Domain Coordinates for d2gcja1:

Click to download the PDB-style file with coordinates for d2gcja1.
(The format of our PDB-style files is described here.)

Timeline for d2gcja1: