Lineage for d2gcjd_ (2gcj D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062109Family b.55.1.10: SSRP1-like [141436] (2 protein domains)
    Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold
  6. 2062110Protein FACT complex subunit POB3, middle domain [141437] (1 species)
  7. 2062111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries)
    Uniprot Q04636 237-474! Uniprot Q04636 238-474
  8. 2062116Domain d2gcjd_: 2gcj D: [134990]
    automated match to d2gcja1

Details for d2gcjd_

PDB Entry: 2gcj (more details), 2.55 Å

PDB Description: Crystal Structure of the Pob3 middle domain
PDB Compounds: (D:) Hypothetical 63.0 kDa protein in DAK1-ORC1 intergenic region

SCOPe Domain Sequences for d2gcjd_:

Sequence, based on SEQRES records: (download)

>d2gcjd_ b.55.1.10 (D:) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

Sequence, based on observed residues (ATOM records): (download)

>d2gcjd_ b.55.1.10 (D:) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl
lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl
shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv
smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn

SCOPe Domain Coordinates for d2gcjd_:

Click to download the PDB-style file with coordinates for d2gcjd_.
(The format of our PDB-style files is described here.)

Timeline for d2gcjd_: