Lineage for d2gc4g_ (2gc4 G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774129Protein Amicyanin [49505] (2 species)
  7. 1774130Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 1774166Domain d2gc4g_: 2gc4 G: [134940]
    Other proteins in same PDB: d2gc4a_, d2gc4b_, d2gc4d_, d2gc4e_, d2gc4f_, d2gc4h_, d2gc4i_, d2gc4j_, d2gc4l_, d2gc4m_, d2gc4n_, d2gc4p_
    automated match to d1aac__
    complexed with cu, hem, na

Details for d2gc4g_

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (G:) amicyanin

SCOPe Domain Sequences for d2gc4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4g_ b.6.1.1 (G:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d2gc4g_:

Click to download the PDB-style file with coordinates for d2gc4g_.
(The format of our PDB-style files is described here.)

Timeline for d2gc4g_: