Lineage for d2gble2 (2gbl E:256-497)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1165223Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1165383Protein Circadian clock protein KaiC [110558] (1 species)
    duplication: contains two copies of this domain
  7. 1165384Species Synechococcus elongatus PCC 7942 [TaxId:1140] [110559] (3 PDB entries)
    Uniprot Q79PF4 14-497
  8. 1165418Domain d2gble2: 2gbl E:256-497 [134920]
    automatically matched to d1tf7a2
    complexed with atp, mg

Details for d2gble2

PDB Entry: 2gbl (more details), 2.8 Å

PDB Description: crystal structure of full length circadian clock protein kaic with phosphorylation sites
PDB Compounds: (E:) Circadian clock protein kinase kaiC

SCOPe Domain Sequences for d2gble2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gble2 c.37.1.11 (E:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
qrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerailf
ayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpari
aidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshistitd
tiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgspt
ri

SCOPe Domain Coordinates for d2gble2:

Click to download the PDB-style file with coordinates for d2gble2.
(The format of our PDB-style files is described here.)

Timeline for d2gble2: