Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein AAT homologue TM1698 [142661] (1 species) |
Species Thermotoga maritima [TaxId:2336] [142662] (1 PDB entry) Uniprot Q9X224 4-392 |
Domain d2gb3b2: 2gb3 B:1-392 [134904] Other proteins in same PDB: d2gb3b3, d2gb3e3 automated match to d2gb3a1 |
PDB Entry: 2gb3 (more details), 2.5 Å
SCOPe Domain Sequences for d2gb3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gb3b2 c.67.1.1 (B:1-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} mdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpev vyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvl epfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvyg kdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgar vgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlk kleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpgl gkkeiriacvlekdllsraidvlmeglkmfcs
Timeline for d2gb3b2: