Lineage for d2gana1 (2gan A:1-182)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427026Protein Hypothetical protein PH0736 [143666] (1 species)
  7. 1427027Species Pyrococcus horikoshii [TaxId:53953] [143667] (1 PDB entry)
    Uniprot O58467 1-182
  8. 1427028Domain d2gana1: 2gan A:1-182 [134889]
    complexed with edo, so4

Details for d2gana1

PDB Entry: 2gan (more details), 2.1 Å

PDB Description: crystal structure of a putative acetyltransferase from pyrococcus horikoshii, northeast structural genomics target jr32.
PDB Compounds: (A:) 182aa long hypothetical protein

SCOPe Domain Sequences for d2gana1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}
megvkkiknpstvkdellelmfriyrstngkypalewvkrkpnpndfngfrevyepflkf
rlsqefdelytyqkdnriigtialvykrikekgiwwvpeelmnekvglieffvvdpefqg
kgigstllefavkrlrslgkdpyvvtfpnleaysyyymkkgfreimrykefvilkfnhkk
fq

SCOPe Domain Coordinates for d2gana1:

Click to download the PDB-style file with coordinates for d2gana1.
(The format of our PDB-style files is described here.)

Timeline for d2gana1: