| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
| Protein Hypothetical protein PH0736 [143666] (1 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [143667] (1 PDB entry) Uniprot O58467 1-182 |
| Domain d2gana1: 2gan A:1-182 [134889] Other proteins in same PDB: d2gana2 complexed with edo, so4 |
PDB Entry: 2gan (more details), 2.1 Å
SCOPe Domain Sequences for d2gana1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}
megvkkiknpstvkdellelmfriyrstngkypalewvkrkpnpndfngfrevyepflkf
rlsqefdelytyqkdnriigtialvykrikekgiwwvpeelmnekvglieffvvdpefqg
kgigstllefavkrlrslgkdpyvvtfpnleaysyyymkkgfreimrykefvilkfnhkk
fq
Timeline for d2gana1: