SCOPe 2.08: Domain d2gana1: 2gan A:1-182

Lineage for d2gana1 (2gan A:1-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein PH0736 [143666] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143667] (1 PDB entry)
   Uniprot O58467 1-182

8. Domain d2gana1: 2gan A:1-182 [134889]
   Other proteins in same PDB: d2gana2
   complexed with edo, so4

Details for d2gana1

PDB Entry: 2gan, 2.1 Å

PDB Description: crystal structure of a putative acetyltransferase from pyrococcus horikoshii, northeast structural genomics target jr32.

PDB Compounds: (A:) 182aa long hypothetical protein

SCOPe Domain Sequences for d2gana1:

Sequence; same for both SEQRES and ATOM records:

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}
megvkkiknpstvkdellelmfriyrstngkypalewvkrkpnpndfngfrevyepflkf
rlsqefdelytyqkdnriigtialvykrikekgiwwvpeelmnekvglieffvvdpefqg
kgigstllefavkrlrslgkdpyvvtfpnleaysyyymkkgfreimrykefvilkfnhkk
fq

Timeline for d2gana1:

• d2gana1 first appeared in SCOP 1.73
  
• d2gana1 appears in SCOPe 2.07