| Class b: All beta proteins [48724] (176 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
| Species Enterobacteria phage [TaxId:10730] [187110] (1 PDB entry) |
| Domain d2ga4d_: 2ga4 D: [134857] Other proteins in same PDB: d2ga4a_ automated match to d1r4pb_ complexed with 1ps, ade, edo, fmt, na |
PDB Entry: 2ga4 (more details), 1.8 Å
SCOPe Domain Sequences for d2ga4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ga4d_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Enterobacteria phage [TaxId: 10730]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd
Timeline for d2ga4d_: