Lineage for d2ga4c_ (2ga4 C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1314026Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1314027Species Enterobacteria phage [TaxId:10730] [187110] (1 PDB entry)
  8. 1314029Domain d2ga4c_: 2ga4 C: [134856]
    Other proteins in same PDB: d2ga4a_
    automated match to d1r4pb_
    complexed with 1ps, ade, edo, fmt, na

Details for d2ga4c_

PDB Entry: 2ga4 (more details), 1.8 Å

PDB Description: stx2 with adenine
PDB Compounds: (C:) Shiga-like toxin II subunit B

SCOPe Domain Sequences for d2ga4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ga4c_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Enterobacteria phage [TaxId: 10730]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d2ga4c_:

Click to download the PDB-style file with coordinates for d2ga4c_.
(The format of our PDB-style files is described here.)

Timeline for d2ga4c_: