SCOP 1.73: Domain d2ga4c1: 2ga4 C:1-70

Lineage for d2ga4c1 (2ga4 C:1-70)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (2 PDB entries)

8. Domain d2ga4c1: 2ga4 C:1-70 [134856]
   Other proteins in same PDB: d2ga4a1
   automatically matched to d1r4pb_
   complexed with 1ps, ade, edo, fmt, na

Details for d2ga4c1

PDB Entry: 2ga4, 1.8 Å

PDB Description: stx2 with adenine

PDB Compounds: (C:) Shiga-like toxin II subunit B

SCOP Domain Sequences for d2ga4c1:

Sequence; same for both SEQRES and ATOM records:

>d2ga4c1 b.40.2.1 (C:1-70) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

Timeline for d2ga4c1:

• d2ga4c1 is new in SCOP 1.73
  
• d2ga4c1 appears in SCOP 1.75
  
• d2ga4c1 appears in the current release, SCOPe 2.08, called d2ga4c_