SCOPe 2.08: Domain d2g9jb1: 2g9j B:1-32

Lineage for d2g9jb1 (2g9j B:1-32)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (2 families)

5. Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)

6. Protein GCN4 [57961] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries)
   Uniprot P03069 249-279 ! Uniprot P03069 249-281

8. Domain d2g9jb1: 2g9j B:1-32 [134809]
   Other proteins in same PDB: d2g9ja2, d2g9jb2, d2g9jc1, d2g9jc2, d2g9jd1, d2g9jd2
   automatically matched to 2G9J A:1-32

Details for d2g9jb1

PDB Entry: 2g9j

PDB Description: complex of tm1a(1-14)zip with tm9a(251-284): a model for the polymerization domain ("overlap region") of tropomyosin, northeast structural genomics target or9

PDB Compounds: (B:) Tropomyosin 1 alpha chain/General control protein GCN4

SCOPe Domain Sequences for d2g9jb1:

Sequence; same for both SEQRES and ATOM records:

>d2g9jb1 h.1.3.1 (B:1-32) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdaikkkmqmlkldnyhlenevarlkklvger

Timeline for d2g9jb1:

• d2g9jb1 first appeared in SCOP 1.73
  
• d2g9jb1 appears in SCOPe 2.07