SCOP 1.73: Domain d2g9ha2: 2g9h A:13-81

Lineage for d2g9ha2 (2g9h A:13-81)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (11 PDB entries)

8. Domain d2g9ha2: 2g9h A:13-81 [134803]
   Other proteins in same PDB: d2g9ha1, d2g9hb1, d2g9hb2
   automatically matched to d1k2da2
   complexed with dio, epe, so4, zn

Details for d2g9ha2

PDB Entry: 2g9h, 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d2g9ha2:

Sequence; same for both SEQRES and ATOM records:

>d2g9ha2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

Timeline for d2g9ha2:

• d2g9ha2 is new in SCOP 1.73
  
• d2g9ha2 appears in SCOP 1.75
  
• d2g9ha2 appears in the current release, SCOPe 2.08