Lineage for d2g9ha2 (2g9h A:5-81)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)
  8. Domain d2g9ha2: 2g9h A:5-81 [134803]
    Other proteins in same PDB: d2g9ha1, d2g9ha3, d2g9hb1, d2g9hb2, d2g9hd1, d2g9hd2
    automatically matched to d1k2da2
    complexed with dio, epe, so4, zn

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2g9ha2

PDB Entry: 2g9h (more details), 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2g9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9ha2 d.19.1.1 (A:5-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania
vdkanleimtkrsnytp

SCOPe Domain Coordinates for d2g9ha2 are not available.

Timeline for d2g9ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g9ha1, d2g9ha3
View in 3D
Domains from other chains:
(mouse over for more information)
d2g9hb1, d2g9hb2, d2g9hd1, d2g9hd2