SCOPe 2.02: Domain d2g8ia_: 2g8i A:

Lineage for d2g8ia_ (2g8i A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (16 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d2g8ia_: 2g8i A: [134772]
   automated match to d1zbla1
   protein/DNA complex; protein/RNA complex; complexed with cl, mn, mpd; mutant

Details for d2g8ia_

PDB Entry: 2g8i, 1.65 Å

PDB Description: b. halodurans rnase h catalytic domain d192n mutant in complex with mn2+ and rna/dna hybrid (non-p nick at the active site)

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2g8ia_:

Sequence; same for both SEQRES and ATOM records:

>d2g8ia_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikanygr

Timeline for d2g8ia_:

• d2g8ia_ first appeared in SCOP 1.73, called d2g8ia1
  
• d2g8ia_ appears in SCOPe 2.01
  
• d2g8ia_ appears in SCOPe 2.03
  
• d2g8ia_ appears in the current release, SCOPe 2.08