Lineage for d2g8fa1 (2g8f A:61-193)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606597Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1606598Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 1606599Species Bacillus halodurans [TaxId:86665] [142491] (19 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 1606607Domain d2g8fa1: 2g8f A:61-193 [134770]
    protein/DNA complex; protein/RNA complex; complexed with cl, mg; mutant

Details for d2g8fa1

PDB Entry: 2g8f (more details), 1.65 Å

PDB Description: b. halodurans rnase h catalytic domain e188a mutant in complex with mg2+ and rna/dna hybrid (non-p nick at the active site)
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2g8fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8fa1 c.55.3.1 (A:61-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgaikady

SCOPe Domain Coordinates for d2g8fa1:

Click to download the PDB-style file with coordinates for d2g8fa1.
(The format of our PDB-style files is described here.)

Timeline for d2g8fa1: