|  | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) | 
|  | Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane | 
|  | Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)  Pfam PF13853. Phylogeny described in PubMed 12761335 | 
|  | Family f.13.1.2: Rhodopsin-like [81320] (2 proteins) Individual TM segments have a number of kinks and distortions | 
|  | Protein automated matches [190300] (1 species) not a true protein | 
|  | Species Cow (Bos taurus) [TaxId:9913] [188510] (18 PDB entries) | 
|  | Domain d2g87a_: 2g87 A: [134767] automated match to d1f88a_ complexed with hg, htg, hto, plm, ret, zn | 
PDB Entry: 2g87 (more details), 2.6 Å
SCOPe Domain Sequences for d2g87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g87a_ f.13.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa
Timeline for d2g87a_: