Class a: All alpha proteins [46456] (285 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries) |
Domain d2g83b1: 2g83 B:61-181 [134764] Other proteins in same PDB: d2g83a2, d2g83b2 automatically matched to d1kjya1 complexed with alf, gdp, mg |
PDB Entry: 2g83 (more details), 2.8 Å
SCOPe Domain Sequences for d2g83b1:
Sequence, based on SEQRES records: (download)
>d2g83b1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
>d2g83b1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlaelagvikrl wkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
Timeline for d2g83b1: