SCOPe 2.04: Domain d2g83b1: 2g83 B:61-181

Lineage for d2g83b1 (2g83 B:61-181)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries)

8. Domain d2g83b1: 2g83 B:61-181 [134764]
   Other proteins in same PDB: d2g83a2, d2g83b2
   automatically matched to d1kjya1
   complexed with alf, gdp, mg

Details for d2g83b1

PDB Entry: 2g83, 2.8 Å

PDB Description: Structure of activated G-alpha-i1 bound to a nucleotide-state-selective peptide: Minimal determinants for recognizing the active form of a G protein alpha subunit

PDB Compounds: (B:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2g83b1:

Sequence, based on SEQRES records:

>d2g83b1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records):

>d2g83b1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlaelagvikrl
wkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

Timeline for d2g83b1:

• d2g83b1 first appeared in SCOP 1.73
  
• d2g83b1 appears in SCOPe 2.03
  
• d2g83b1 appears in SCOPe 2.05
  
• d2g83b1 appears in the current release, SCOPe 2.08