Lineage for d2g83a2 (2g83 A:33-60,A:182-345)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164431Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1164453Species Human (Homo sapiens) [TaxId:9606] [159560] (7 PDB entries)
  8. 1164466Domain d2g83a2: 2g83 A:33-60,A:182-345 [134763]
    Other proteins in same PDB: d2g83a1, d2g83b1
    automatically matched to d1kjya2
    complexed with alf, gdp, mg

Details for d2g83a2

PDB Entry: 2g83 (more details), 2.8 Å

PDB Description: Structure of activated G-alpha-i1 bound to a nucleotide-state-selective peptide: Minimal determinants for recognizing the active form of a G protein alpha subunit
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2g83a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g83a2 c.37.1.8 (A:33-60,A:182-345) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviik

SCOPe Domain Coordinates for d2g83a2:

Click to download the PDB-style file with coordinates for d2g83a2.
(The format of our PDB-style files is described here.)

Timeline for d2g83a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g83a1