SCOPe 2.07: Domain d2g5lb_: 2g5l B:

Lineage for d2g5lb_ (2g5l B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d2g5lb_: 2g5l B: [134668]
   automated match to d1n9mc_
   complexed with gol, so4

Details for d2g5lb_

PDB Entry: 2g5l, 1.15 Å

PDB Description: Streptavidin in complex with Nanotag

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d2g5lb_:

Sequence, based on SEQRES records:

>d2g5lb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Sequence, based on observed residues (ATOM records):

>d2g5lb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyyvltgrydsapatdgsgtalgwtvawknahsa
ttwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d2g5lb_:

• d2g5lb_ first appeared in SCOP 1.73, called d2g5lb1
  
• d2g5lb_ appears in SCOPe 2.06
  
• d2g5lb_ appears in the current release, SCOPe 2.08