Lineage for d2g5cc1 (2g5c C:201-307)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276493Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
    new dimerisation mode with swapping of C-terminal helices
  6. 1276494Protein Prephenate dehydrogenase TyrA [140781] (3 species)
  7. 1276495Species Aquifex aeolicus [TaxId:63363] [140782] (1 PDB entry)
    Uniprot O67636 201-310
  8. 1276498Domain d2g5cc1: 2g5c C:201-307 [134650]
    Other proteins in same PDB: d2g5ca2, d2g5cb2, d2g5cc2, d2g5cd2
    automated match to d2g5ca1
    complexed with nad

Details for d2g5cc1

PDB Entry: 2g5c (more details), 1.9 Å

PDB Description: Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus
PDB Compounds: (C:) prephenate dehydrogenase

SCOPe Domain Sequences for d2g5cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5cc1 a.100.1.12 (C:201-307) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
spelhdyvfgvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwr
diflenkenvmkaiegfekslnhlkelivreaeeelveylkevkikr

SCOPe Domain Coordinates for d2g5cc1:

Click to download the PDB-style file with coordinates for d2g5cc1.
(The format of our PDB-style files is described here.)

Timeline for d2g5cc1: