Lineage for d2g5cc1 (2g5c C:201-307)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645590Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 645591Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 645754Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
    new dimerisation mode with swapping of C-terminal helices
  6. 645755Protein Prephenate dehydrogenase TyrA [140781] (2 species)
  7. 645756Species Aquifex aeolicus [TaxId:63363] [140782] (1 PDB entry)
  8. 645759Domain d2g5cc1: 2g5c C:201-307 [134650]
    Other proteins in same PDB: d2g5ca2, d2g5cb2, d2g5cc2, d2g5cd2
    automatically matched to 2G5C A:201-310
    complexed with nad

Details for d2g5cc1

PDB Entry: 2g5c (more details), 1.9 Å

PDB Description: Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus
PDB Compounds: (C:) prephenate dehydrogenase

SCOP Domain Sequences for d2g5cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5cc1 a.100.1.12 (C:201-307) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
spelhdyvfgvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwr
diflenkenvmkaiegfekslnhlkelivreaeeelveylkevkikr

SCOP Domain Coordinates for d2g5cc1:

Click to download the PDB-style file with coordinates for d2g5cc1.
(The format of our PDB-style files is described here.)

Timeline for d2g5cc1: