| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein Trypsin(ogen) [50515] (9 species) |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries) |
| Domain d2g52a_: 2g52 A: [134643] automated match to d1fn8a_ complexed with so4 |
PDB Entry: 2g52 (more details), 1.84 Å
SCOPe Domain Sequences for d2g52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g52a_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
Timeline for d2g52a_: