Lineage for d2g40a1 (2g40 A:38-212)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169412Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2169413Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2169665Family c.124.1.7: YkgG-like [142200] (1 protein)
    Pfam PF02589; DUF162
  6. 2169666Protein Hypothetical protein DR1909 [142201] (1 species)
  7. 2169667Species Deinococcus radiodurans [TaxId:1299] [142202] (1 PDB entry)
    Uniprot Q9RT57 38-212
  8. 2169668Domain d2g40a1: 2g40 A:38-212 [134575]

Details for d2g40a1

PDB Entry: 2g40 (more details), 1.7 Å

PDB Description: Crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 A resolution
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2g40a1:

Sequence, based on SEQRES records: (download)

>d2g40a1 c.124.1.7 (A:38-212) Hypothetical protein DR1909 {Deinococcus radiodurans [TaxId: 1299]}
plsraeilhqfedrildygaaythvsaaelpgaiakalgnarrvivpagipapwltvgmd
vlrdepplshaeldradavltgcavaisetgtiildhradqgrralslipdfhicvvred
qivqtvregveavaasvregrpltwlsggsatsdielvrvegvhgprrlqvivvg

Sequence, based on observed residues (ATOM records): (download)

>d2g40a1 c.124.1.7 (A:38-212) Hypothetical protein DR1909 {Deinococcus radiodurans [TaxId: 1299]}
plsraeilhqfedrildygaaythvsaaelpgaiakalgnarrvivpagipapwltvgmd
vlrdepplshaeldradavltgcavaisetgtiildhradqgrralslipdfhicvvred
qivqtvregveavaasvregrpltwlsggsgvhgprrlqvivvg

SCOPe Domain Coordinates for d2g40a1:

Click to download the PDB-style file with coordinates for d2g40a1.
(The format of our PDB-style files is described here.)

Timeline for d2g40a1: