Lineage for d2g3tb_ (2g3t B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921280Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1921623Protein automated matches [190241] (10 species)
    not a true protein
  7. 1921640Species Human (Homo sapiens) [TaxId:9606] [187321] (9 PDB entries)
  8. 1921643Domain d2g3tb_: 2g3t B: [134573]
    automated match to d2b3ua1

Details for d2g3tb_

PDB Entry: 2g3t (more details), 1.8 Å

PDB Description: crystal structure of human spermidine/spermine n1-acetyltransferase (hssat)
PDB Compounds: (B:) Diamine acetyltransferase 1

SCOPe Domain Sequences for d2g3tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3tb_ d.108.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke
hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc
ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate

SCOPe Domain Coordinates for d2g3tb_:

Click to download the PDB-style file with coordinates for d2g3tb_.
(The format of our PDB-style files is described here.)

Timeline for d2g3tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2g3ta_