SCOP 1.75: Domain d2g3bb1: 2g3b B:2-73

Lineage for d2g3bb1 (2g3b B:2-73)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Putative transcriptional regulator [140177] (1 species)

7. Species Rhodococcus sp. rha1 [TaxId:101510] [140178] (1 PDB entry)

8. Domain d2g3bb1: 2g3b B:2-73 [134560]
   Other proteins in same PDB: d2g3ba2, d2g3bb2
   automatically matched to 2G3B A:2-73
   complexed with gol

Details for d2g3bb1

PDB Entry: 2g3b, 2 Å

PDB Description: crystal structure of putative tetr-family transcriptional regulator from rhodococcus sp.

PDB Compounds: (B:) Putative tetR-family transcriptional regulator

SCOP Domain Sequences for d2g3bb1:

Sequence; same for both SEQRES and ATOM records:

>d2g3bb1 a.4.1.9 (B:2-73) Putative transcriptional regulator {Rhodococcus sp. rha1 [TaxId: 101510]}
serrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyindr
arayrsegegsg

Timeline for d2g3bb1:

• d2g3bb1 first appeared in SCOP 1.73
  
• d2g3bb1 appears in SCOPe 2.01
  
• d2g3bb1 appears in the current release, SCOPe 2.08