![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative transcriptional regulator [140177] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [140178] (1 PDB entry) |
![]() | Domain d2g3bb1: 2g3b B:2-73 [134560] Other proteins in same PDB: d2g3ba2, d2g3bb2 automated match to d2g3ba1 complexed with gol |
PDB Entry: 2g3b (more details), 2 Å
SCOPe Domain Sequences for d2g3bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3bb1 a.4.1.9 (B:2-73) Putative transcriptional regulator {Rhodococcus sp. RHA1 [TaxId: 101510]} serrdailkasataiaqrgirglrvndvaevagvspgllyyhfkdriglleaalnyindr arayrsegegsg
Timeline for d2g3bb1: