Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) contains an additional N-terminal strand |
Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains |
Protein Beta2-adaptin AP2 ear domain, N-terminal subdomain [49352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49353] (4 PDB entries) |
Domain d2g30a1: 2g30 A:705-824 [134546] Other proteins in same PDB: d2g30a2 automatically matched to d1e42a1 |
PDB Entry: 2g30 (more details), 1.6 Å
SCOPe Domain Sequences for d2g30a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g30a1 b.1.10.1 (A:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} ggyvapkavwlpavkakgleisgtfthrqghiymemnftnkalqhmtdfaiqfnknsfgv ipstplaihtplmpnqsidvslplntlgpvmkmeplnnlqvavknnidvfyfscliplnv
Timeline for d2g30a1: