Lineage for d2g1ab_ (2g1a B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1187954Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 1187955Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 1187956Species Escherichia coli [TaxId:562] [102309] (11 PDB entries)
    Uniprot P32697 27-237
  8. 1187972Domain d2g1ab_: 2g1a B: [134515]
    automated match to d1rm7a_
    complexed with 5hg, mg

Details for d2g1ab_

PDB Entry: 2g1a (more details), 2 Å

PDB Description: Crystal structure of the complex between Apha class B acid phosphatase/phosphotransferase
PDB Compounds: (B:) Class B acid phosphatase

SCOPe Domain Sequences for d2g1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g1ab_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d2g1ab_:

Click to download the PDB-style file with coordinates for d2g1ab_.
(The format of our PDB-style files is described here.)

Timeline for d2g1ab_: